Lineage for d4g82a1 (4g82 A:115-312)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377884Protein automated matches [190198] (2 species)
    not a true protein
  7. 2377885Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2377994Domain d4g82a1: 4g82 A:115-312 [252161]
    Other proteins in same PDB: d4g82a2, d4g82b2
    automated match to d3vd0d_
    protein/DNA complex; complexed with zn

Details for d4g82a1

PDB Entry: 4g82 (more details), 3.1 Å

PDB Description: crystal structure of p73 dna-binding domain tetramer bound to a full response-element
PDB Compounds: (A:) Tumor protein p73

SCOPe Domain Sequences for d4g82a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g82a1 b.2.5.2 (A:115-312) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipsntdypgphhfevtfqqsstaksatwtyspllkklycqiaktcpiqikvstppppgta
irampvykkaehvtdvvkrcpnhelgrdfnegqsapashlirvegnnlsqyvddpvtgrq
svvvpyeppqvgtefttilynfmcnsscvggmnrrpiliiitlemrdgqvlgrrsfegri
cacpgrdrkadedhyreq

SCOPe Domain Coordinates for d4g82a1:

Click to download the PDB-style file with coordinates for d4g82a1.
(The format of our PDB-style files is described here.)

Timeline for d4g82a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4g82a2