| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
| Protein Cytochrome c oxidase [49544] (4 species) |
| Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries) |
| Domain d4g7rb2: 4g7r B:37-168 [252160] Other proteins in same PDB: d4g7ra_, d4g7rb1 automated match to d3qjsb2 complexed with cu, cua, has, hem, olc, per; mutant |
PDB Entry: 4g7r (more details), 3.05 Å
SCOPe Domain Sequences for d4g7rb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g7rb2 b.6.1.2 (B:37-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
lathtagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpie
vpqgaeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglg
hqnmfgtivvke
Timeline for d4g7rb2: