Lineage for d1b1za1 (1b1z A:3-107)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789051Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 2789052Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
    Uniprot P08095
  8. 2789059Domain d1b1za1: 1b1z A:3-107 [25216]
    Other proteins in same PDB: d1b1za2, d1b1zb2, d1b1zc2, d1b1zd2

Details for d1b1za1

PDB Entry: 1b1z (more details), 2.57 Å

PDB Description: streptococcal pyrogenic exotoxin a1
PDB Compounds: (A:) protein (toxin)

SCOPe Domain Sequences for d1b1za1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1za1 b.40.2.2 (A:3-107) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
dpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklktel
knqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOPe Domain Coordinates for d1b1za1:

Click to download the PDB-style file with coordinates for d1b1za1.
(The format of our PDB-style files is described here.)

Timeline for d1b1za1: