Lineage for d4g4ra2 (4g4r A:135-216)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735301Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 2735302Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 2735377Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
    contains 4 helices in the core
  6. 2735378Protein DNA repair protein MutM (Fpg) [81620] (4 species)
  7. 2735379Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)
  8. 2735384Domain d4g4ra2: 4g4r A:135-216 [252151]
    Other proteins in same PDB: d4g4ra1, d4g4ra3
    automated match to d1r2za1
    protein/DNA complex; complexed with zn; mutant

Details for d4g4ra2

PDB Entry: 4g4r (more details), 1.95 Å

PDB Description: MutM containing F114A mutation bound to oxoG-containing DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d4g4ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4ra2 a.156.1.2 (A:135-216) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavm

SCOPe Domain Coordinates for d4g4ra2:

Click to download the PDB-style file with coordinates for d4g4ra2.
(The format of our PDB-style files is described here.)

Timeline for d4g4ra2: