Lineage for d4g4qa3 (4g4q A:237-274)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705142Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1705143Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1705529Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins)
  6. Protein DNA repair protein MutM (Fpg) [81622] (4 species)
  7. Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries)
  8. 1705538Domain d4g4qa3: 4g4q A:237-274 [252149]
    Other proteins in same PDB: d4g4qa1, d4g4qa2
    automated match to d1r2za3
    protein/DNA complex; complexed with zn; mutant

Details for d4g4qa3

PDB Entry: 4g4q (more details), 1.86 Å

PDB Description: MutM containing F114A mutation bound to undamaged DNA
PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d4g4qa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g4qa3 g.39.1.8 (A:237-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
hhlyvygrqgnpckrcgtpiektvvagrgthycprcqr

SCOPe Domain Coordinates for d4g4qa3:

Click to download the PDB-style file with coordinates for d4g4qa3.
(The format of our PDB-style files is described here.)

Timeline for d4g4qa3: