SCOPe 2.06: Domain d4g4qa2: 4g4q A:135-217

Lineage for d4g4qa2 (4g4q A:135-217)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
   core: 3-4 helices

4. Superfamily a.156.1: S13-like H2TH domain [46946] (4 families)
   contains a helix-two turns-helix (H2TH) motif

5. Family a.156.1.2: Middle domain of MutM-like DNA repair proteins [81626] (3 proteins)
   contains 4 helices in the core

6. Protein DNA repair protein MutM (Fpg) [81620] (4 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [81611] (23 PDB entries)

8. Domain d4g4qa2: 4g4q A:135-217 [252148]
   Other proteins in same PDB: d4g4qa1, d4g4qa3
   automated match to d1r2za1
   protein/DNA complex; complexed with zn; mutant

Details for d4g4qa2

PDB Entry: 4g4q, 1.86 Å

PDB Description: MutM containing F114A mutation bound to undamaged DNA

PDB Compounds: (A:) formamidopyrimidine-DNA glycosylase

SCOPe Domain Sequences for d4g4qa2:

Sequence; same for both SEQRES and ATOM records:

>d4g4qa2 a.156.1.2 (A:135-217) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]}
gpeplspafspavlaeravktkrsvkallldctvvagfgniyvdeslfragilpgrpaas
lsskeierlheemvatigeavmk

Timeline for d4g4qa2:

• d4g4qa2 first appeared in SCOPe 2.04
  
• d4g4qa2 appears in SCOPe 2.05
  
• d4g4qa2 appears in SCOPe 2.07
  
• d4g4qa2 appears in the current release, SCOPe 2.08