![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
![]() | Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) ![]() automatically mapped to Pfam PF01149 |
![]() | Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81621] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81612] (23 PDB entries) |
![]() | Domain d4g4qa1: 4g4q A:2-134 [252147] Other proteins in same PDB: d4g4qa2, d4g4qa3 automated match to d1r2za2 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 4g4q (more details), 1.86 Å
SCOPe Domain Sequences for d4g4qa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4qa1 b.113.1.1 (A:2-134) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} pelpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkagtmhvya keeadrrpplael
Timeline for d4g4qa1: