![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
![]() | Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) ![]() |
![]() | Family g.39.1.8: C-terminal, Zn-finger domain of MutM-like DNA repair proteins [81627] (3 proteins) |
![]() | Protein DNA repair protein MutM (Fpg) [81622] (4 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [81613] (23 PDB entries) |
![]() | Domain d4g4na3: 4g4n A:238-274 [252143] Other proteins in same PDB: d4g4na1, d4g4na2 automated match to d1r2za3 protein/DNA complex; complexed with zn; mutant |
PDB Entry: 4g4n (more details), 1.85 Å
SCOPe Domain Sequences for d4g4na3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g4na3 g.39.1.8 (A:238-274) DNA repair protein MutM (Fpg) {Bacillus stearothermophilus [TaxId: 1422]} hlyvygrqgnpckrcgtpiektvvagrgthycprcqr
Timeline for d4g4na3: