SCOPe 2.08: Domain d4g38a1: 4g38 A:81-145

Lineage for d4g38a1 (4g38 A:81-145)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.36.0: automated matches [254283] (1 protein)
   not a true family

6. Protein automated matches [254662] (3 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [256262] (3 PDB entries)

8. Domain d4g38a1: 4g38 A:81-145 [252133]
   Other proteins in same PDB: d4g38a2, d4g38a4
   automated match to d1aopa1
   complexed with k, po4, sf4, srm; mutant

Details for d4g38a1

PDB Entry: 4g38, 1.56 Å

PDB Description: mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer

PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4g38a1:

Sequence, based on SEQRES records:

>d4g38a1 d.58.36.0 (A:81-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv
gldal

Sequence, based on observed residues (ATOM records):

>d4g38a1 d.58.36.0 (A:81-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal

Timeline for d4g38a1:

• d4g38a1 first appeared in SCOPe 2.04
  
• d4g38a1 appears in SCOPe 2.07