Lineage for d4g38a1 (4g38 A:81-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955424Superfamily d.58.36: Nitrite/Sulfite reductase N-terminal domain-like [55124] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 2955515Family d.58.36.0: automated matches [254283] (1 protein)
    not a true family
  6. 2955516Protein automated matches [254662] (3 species)
    not a true protein
  7. 2955517Species Escherichia coli K-12 [TaxId:83333] [256262] (3 PDB entries)
  8. 2955518Domain d4g38a1: 4g38 A:81-145 [252133]
    Other proteins in same PDB: d4g38a2, d4g38a4
    automated match to d1aopa1
    complexed with k, po4, sf4, srm; mutant

Details for d4g38a1

PDB Entry: 4g38 (more details), 1.56 Å

PDB Description: mutational analysis of sulfite reductase hemoprotein reveals the mechanism for coordinated electron and proton transfer
PDB Compounds: (A:) Sulfite reductase [NADPH] hemoprotein beta-component

SCOPe Domain Sequences for d4g38a1:

Sequence, based on SEQRES records: (download)

>d4g38a1 d.58.36.0 (A:81-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilkknvkpvhqmlhsv
gldal

Sequence, based on observed residues (ATOM records): (download)

>d4g38a1 d.58.36.0 (A:81-145) automated matches {Escherichia coli K-12 [TaxId: 83333]}
llrcrlpggvittkqwqaidkfagentiygsirltnrqtfqfhgilpvhqmlhsvgldal

SCOPe Domain Coordinates for d4g38a1:

Click to download the PDB-style file with coordinates for d4g38a1.
(The format of our PDB-style files is described here.)

Timeline for d4g38a1: