SCOPe 2.06: Domain d4g2lb1: 4g2l B:182-505

Lineage for d4g2lb1 (4g2l B:182-505)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families)

5. Family a.211.1.2: PDEase [48548] (7 proteins)
   Pfam PF00233; multihelical; can be divided into three subdomains

6. Protein High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A [109942] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109943] (20 PDB entries)
   Uniprot O76083 241-566

8. Domain d4g2lb1: 4g2l B:182-505 [252132]
   Other proteins in same PDB: d4g2la2, d4g2lb2
   automated match to d3dy8a_
   complexed with 0wl, mg, zn

Details for d4g2lb1

PDB Entry: 4g2l, 3 Å

PDB Description: Human PDE9 in complex with selective compound

PDB Compounds: (B:) High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A

SCOPe Domain Sequences for d4g2lb1:

Sequence; same for both SEQRES and ATOM records:

>d4g2lb1 a.211.1.2 (B:182-505) High-affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}
typkyllspetiealrkptfdvwlwepnemlsclehmyhdlglvrdfsinpvtlrrwlfc
vhdnyrnnpfhnfrhcfcvaqmmysmvwlcslqekfsqtdililmtaaichdldhpgynn
tyqinartelavryndisplenhhcavafqilaepecnifsnippdgfkqirqgmitlil
atdmarhaeimdsfkekmenfdysneehmtllkmilikccdisnevrpmevaepwvdcll
eeyfmqsdrekseglpvapfmdrdkvtkataqigfikfvlipmfetvtklfpmveeimlq
plwesrdryeelkriddamkelqk

Timeline for d4g2lb1:

• d4g2lb1 first appeared in SCOPe 2.04, called d4g2lb_
  
• d4g2lb1 was called d4g2lb_ in SCOPe 2.05
  
• d4g2lb1 appears in SCOPe 2.07
  
• d4g2lb1 appears in the current release, SCOPe 2.08