SCOPe 2.08: Domain d4g2kc_: 4g2k C:

Lineage for d4g2kc_ (4g2k C:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.0: automated matches [254265] (1 protein)
   not a true family

6. Protein automated matches [254613] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId:4932] [256261] (1 PDB entry)

8. Domain d4g2kc_: 4g2k C: [252130]
   automated match to d1eboa_
   complexed with cl, gol

Details for d4g2kc_

PDB Entry: 4g2k, 1.9 Å

PDB Description: crystal structure of the marburg virus gp2 ectodomain in its post- fusion conformation

PDB Compounds: (C:) General control protein GCN4, Envelope glycoprotein GP2 chimera

SCOPe Domain Sequences for d4g2kc_:

Sequence; same for both SEQRES and ATOM records:

>d4g2kc_ h.3.2.0 (C:) automated matches {Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId: 4932]}
kqiedkieeilskiyhieneiarikklignlvsrlrrlanqtakslelllrvtteertfs
linrhaidflltrwggtckvlgpdcsigiedlsrniseqidqikkde

Timeline for d4g2kc_:

• d4g2kc_ first appeared in SCOPe 2.04
  
• d4g2kc_ appears in SCOPe 2.07