Lineage for d1fnub1 (1fnu B:301-407)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 667366Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 667804Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (14 proteins)
  6. 667871Protein Streptococcal pyrogenic exotoxin A1 [50240] (1 species)
  7. 667872Species Streptococcus pyogenes [TaxId:1314] [50241] (8 PDB entries)
  8. 667874Domain d1fnub1: 1fnu B:301-407 [25213]
    Other proteins in same PDB: d1fnua2, d1fnub2, d1fnuc2, d1fnud2

Details for d1fnub1

PDB Entry: 1fnu (more details), 1.94 Å

PDB Description: structure of streptococcal pyrogenic exotoxin a
PDB Compounds: (B:) exotoxin type a precursor (allele 1)

SCOP Domain Sequences for d1fnub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fnub1 b.40.2.2 (B:301-407) Streptococcal pyrogenic exotoxin A1 {Streptococcus pyogenes [TaxId: 1314]}
qqdpdpsqlhrsslvknlqniyflyegdpvthenvksvdqllshdliynvsgpnydklkt
elknqematlfkdknvdiygveyyhlcylcenaersaciyggvtnhe

SCOP Domain Coordinates for d1fnub1:

Click to download the PDB-style file with coordinates for d1fnub1.
(The format of our PDB-style files is described here.)

Timeline for d1fnub1: