![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.2: Virus ectodomain [58069] (2 families) ![]() |
![]() | Family h.3.2.0: automated matches [254265] (1 protein) not a true family |
![]() | Protein automated matches [254613] (3 species) not a true protein |
![]() | Species Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId:4932] [256261] (1 PDB entry) |
![]() | Domain d4g2kb_: 4g2k B: [252129] automated match to d1eboa_ complexed with cl, gol |
PDB Entry: 4g2k (more details), 1.9 Å
SCOPe Domain Sequences for d4g2kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g2kb_ h.3.2.0 (B:) automated matches {Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId: 4932]} mkqiedkieeilskiyhieneiarikklignlvsrlrrlanqtakslelllrvtteertf slinrhaidflltrwggtckvlgpdcsigiedlsrniseqidqikkde
Timeline for d4g2kb_: