Lineage for d4g2ka_ (4g2k A:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042189Family h.3.2.0: automated matches [254265] (1 protein)
    not a true family
  6. 3042190Protein automated matches [254613] (3 species)
    not a true protein
  7. 3042203Species Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId:4932] [256261] (1 PDB entry)
  8. 3042204Domain d4g2ka_: 4g2k A: [252128]
    automated match to d1eboa_
    complexed with cl, gol

Details for d4g2ka_

PDB Entry: 4g2k (more details), 1.9 Å

PDB Description: crystal structure of the marburg virus gp2 ectodomain in its post- fusion conformation
PDB Compounds: (A:) General control protein GCN4, Envelope glycoprotein GP2 chimera

SCOPe Domain Sequences for d4g2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g2ka_ h.3.2.0 (A:) automated matches {Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId: 4932]}
mkqiedkieeilskiyhieneiarikklignlvsrlrrlanqtakslelllrvtteertf
slinrhaidflltrwggtckvlgpdcsigiedlsrniseqidqikkdeqk

SCOPe Domain Coordinates for d4g2ka_:

Click to download the PDB-style file with coordinates for d4g2ka_.
(The format of our PDB-style files is described here.)

Timeline for d4g2ka_: