SCOPe 2.08: Domain d4g2ka_: 4g2k A:

Lineage for d4g2ka_ (4g2k A:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.0: automated matches [254265] (1 protein)
   not a true family

6. Protein automated matches [254613] (3 species)
   not a true protein

7. Species Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId:4932] [256261] (1 PDB entry)

8. Domain d4g2ka_: 4g2k A: [252128]
   automated match to d1eboa_
   complexed with cl, gol

Details for d4g2ka_

PDB Entry: 4g2k, 1.9 Å

PDB Description: crystal structure of the marburg virus gp2 ectodomain in its post- fusion conformation

PDB Compounds: (A:) General control protein GCN4, Envelope glycoprotein GP2 chimera

SCOPe Domain Sequences for d4g2ka_:

Sequence; same for both SEQRES and ATOM records:

>d4g2ka_ h.3.2.0 (A:) automated matches {Saccharomyces cerevisiae, lake victoria marburgvirus [TaxId: 4932]}
mkqiedkieeilskiyhieneiarikklignlvsrlrrlanqtakslelllrvtteertf
slinrhaidflltrwggtckvlgpdcsigiedlsrniseqidqikkdeqk

Timeline for d4g2ka_:

• d4g2ka_ first appeared in SCOPe 2.04
  
• d4g2ka_ appears in SCOPe 2.07