Lineage for d4g1ma4 (4g1m A:738-959)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764933Superfamily b.1.15: Integrin domains [69179] (2 families) (S)
  5. 2764962Family b.1.15.0: automated matches [233856] (1 protein)
    not a true family
  6. 2764963Protein automated matches [233857] (1 species)
    not a true protein
  7. 2764964Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)
  8. 2764976Domain d4g1ma4: 4g1m A:738-959 [252126]
    Other proteins in same PDB: d4g1ma1
    automated match to d1m1xa3
    complexed with ca, na, nag

Details for d4g1ma4

PDB Entry: 4g1m (more details), 2.9 Å

PDB Description: re-refinement of alpha v beta 3 structure
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4g1ma4:

Sequence, based on SEQRES records: (download)

>d4g1ma4 b.1.15.0 (A:738-959) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiqpap

Sequence, based on observed residues (ATOM records): (download)

>d4g1ma4 b.1.15.0 (A:738-959) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissdihtlgcgvaqclkivcqvg
rldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstlv
ttnvtwgiqpap

SCOPe Domain Coordinates for d4g1ma4:

Click to download the PDB-style file with coordinates for d4g1ma4.
(The format of our PDB-style files is described here.)

Timeline for d4g1ma4: