Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.15: Integrin domains [69179] (2 families) |
Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
Protein automated matches [233857] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
Domain d4g1ma2: 4g1m A:439-598 [252124] Other proteins in same PDB: d4g1ma1 automated match to d1m1xa1 complexed with ca, na, nag |
PDB Entry: 4g1m (more details), 2.9 Å
SCOPe Domain Sequences for d4g1ma2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4g1ma2 b.1.15.0 (A:439-598) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahilldcge
Timeline for d4g1ma2: