Lineage for d4g1ma1 (4g1m A:1-438)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066356Superfamily b.69.8: Integrin alpha N-terminal domain [69318] (2 families) (S)
  5. 2066357Family b.69.8.1: Integrin alpha N-terminal domain [69319] (2 protein domains)
  6. 2066399Protein automated matches [254690] (1 species)
    not a true protein
  7. 2066400Species Human (Homo sapiens) [TaxId:9606] [255892] (11 PDB entries)
  8. 2066401Domain d4g1ma1: 4g1m A:1-438 [252123]
    Other proteins in same PDB: d4g1ma2, d4g1ma3, d4g1ma4
    automated match to d1m1xa4
    complexed with ca, na, nag

Details for d4g1ma1

PDB Entry: 4g1m (more details), 2.9 Å

PDB Description: Re-refinement of alpha V beta 3 structure
PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d4g1ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g1ma1 b.69.8.1 (A:1-438) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
aapyggedkkgivyifngrstglnavpsqilegqwaarsmppsfgysmkgatdidkngyp
dlivgafgvdrailyrar

SCOPe Domain Coordinates for d4g1ma1:

Click to download the PDB-style file with coordinates for d4g1ma1.
(The format of our PDB-style files is described here.)

Timeline for d4g1ma1: