Lineage for d4g0ra_ (4g0r A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2075417Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2076263Superfamily b.121.5: ssDNA viruses [88645] (3 families) (S)
  5. 2076282Family b.121.5.2: Parvoviridae-like VP [88646] (3 protein domains)
    automatically mapped to Pfam PF00740
  6. 2076308Protein automated matches [190920] (7 species)
    not a true protein
  7. 2076451Species H-1 parvovirus [TaxId:10799] [256260] (1 PDB entry)
  8. 2076452Domain d4g0ra_: 4g0r A: [252120]
    automated match to d1mvma_
    protein/DNA complex; complexed with cl, dc, edo, mg, na

Details for d4g0ra_

PDB Entry: 4g0r (more details), 2.7 Å

PDB Description: Structural characterization of H-1 Parvovirus: comparison of infectious virions to replication defective particles
PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d4g0ra_:

Sequence, based on SEQRES records: (download)

>d4g0ra_ b.121.5.2 (A:) automated matches {H-1 parvovirus [TaxId: 10799]}
gigvstgtydnqttykflgdgwveitahasrllhlgmppsenycrvtvhnnqttghgtkv
kgnmayddthqqiwtpwslvdanawgvwfqpsdwqfiqnsmeslnldslsqelfnvvvkt
vteqqgagqdaikvynndltacmmvaldsnnilpytpaaqtsetlgfypwkptapapyry
yffmprqlsvtssnsaegtqitdtigepqalnsqfftientlpitllrtgdefttgtyif
ntdplklthtwqtnrhlgmppritdlptsdtatasltangdrfgstqtqnvnyvtealrt
rpaqigfmqphdnfeanrggpfkvpvvplditagedhdangairfnygkqhgedwakqga
aperytwdaidsaagrdtarcfvqsapisippnqnqilqredaiagrtnmhytnvfnsyg
plsafphpdpiypngqiwdkeldlehkprlhvtapfvcknnppgqlfvrlgpnltdqfdp
nsttvsrivtystfywkgilkfkaklrpnltwnpvyqattdsvansymnvkkwlpsatgn
mhsdplicrpvphmty

Sequence, based on observed residues (ATOM records): (download)

>d4g0ra_ b.121.5.2 (A:) automated matches {H-1 parvovirus [TaxId: 10799]}
gigvstgtydnqttykflgdgwveitahasrllhlgmppsenycrvtvhnnqttghgtkv
kgnmayddthqqiwtpwslvdanawgvwfqpsdwqfiqnsmeslnldslsqelfnvvvkt
vteqqgagaikvynndltacmmvaldsnnilpytpaaqtsetlgfypwkptapapyryyf
fmprqlsvtssnsaegtqitdtigepqalnsqfftientlpitllrtgdefttgtyifnt
dplklthtwqtnrhlgmppritdlptsdtatasltangdrfgstqtqnvnyvtealrtrp
aqigfmqphdnfeanrggpfkvpvvplditagedhdangairfnygkqhgedwakqgaap
erytwdaidsaagrdtarcfvqsapisippnqnqilqredaiagrtnmhytnvfnsygpl
safphpdpiypngqiwdkeldlehkprlhvtapfvcknnppgqlfvrlgpnltdqfdpns
ttvsrivtystfywkgilkfkaklrpnltwnpvyqattdsvansymnvkkwlpsatgnmh
sdplicrpvphmty

SCOPe Domain Coordinates for d4g0ra_:

Click to download the PDB-style file with coordinates for d4g0ra_.
(The format of our PDB-style files is described here.)

Timeline for d4g0ra_: