Lineage for d1bxtb1 (1bxt B:1-119)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2049950Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2050241Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2050816Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 protein domains)
  6. Protein Streptococcal superantigen SSA [50238] (1 species)
  7. Species Streptococcus pyogenes [TaxId:1314] [50239] (1 PDB entry)
  8. 2050984Domain d1bxtb1: 1bxt B:1-119 [25211]
    Other proteins in same PDB: d1bxta2, d1bxtb2

Details for d1bxtb1

PDB Entry: 1bxt (more details), 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes
PDB Compounds: (B:) protein (streptococcal superantigen)

SCOPe Domain Sequences for d1bxtb1:

Sequence, based on SEQRES records: (download)

>d1bxtb1 b.40.2.2 (B:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncyysegnscknakktcmyggvtehhrn

Sequence, based on observed residues (ATOM records): (download)

>d1bxtb1 b.40.2.2 (B:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes [TaxId: 1314]}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncyyktcmyggvtehhrn

SCOPe Domain Coordinates for d1bxtb1:

Click to download the PDB-style file with coordinates for d1bxtb1.
(The format of our PDB-style files is described here.)

Timeline for d1bxtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxtb2