Lineage for d1bxta1 (1bxt A:1-119)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 166216Fold b.40: OB-fold [50198] (8 superfamilies)
  4. 166278Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 166605Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins)
  6. 166704Protein Streptococcal superantigen SSA [50238] (1 species)
  7. 166705Species Streptococcus pyogenes [TaxId:1314] [50239] (1 PDB entry)
  8. 166706Domain d1bxta1: 1bxt A:1-119 [25210]
    Other proteins in same PDB: d1bxta2, d1bxtb2

Details for d1bxta1

PDB Entry: 1bxt (more details), 1.85 Å

PDB Description: streptococcal superantigen (ssa) from streptococcus pyogenes

SCOP Domain Sequences for d1bxta1:

Sequence, based on SEQRES records: (download)

>d1bxta1 b.40.2.2 (A:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncyysegnscknakktcmyggvtehhrn

Sequence, based on observed residues (ATOM records): (download)

>d1bxta1 b.40.2.2 (A:1-119) Streptococcal superantigen SSA {Streptococcus pyogenes}
ssqpdptpeqlnkssqftgvmgnlrclydnhfvegtnvrstgqllqhdlifpikdlklkn
ydsvktefnskdlatkyknkdvdifgsnyyyncktcmyggvtehhrn

SCOP Domain Coordinates for d1bxta1:

Click to download the PDB-style file with coordinates for d1bxta1.
(The format of our PDB-style files is described here.)

Timeline for d1bxta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bxta2