Lineage for d4fzaa1 (4fza A:11-334)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006773Family a.118.1.15: Mo25 protein [101407] (2 protein domains)
    automatically mapped to Pfam PF08569
  6. 2006779Protein automated matches [191051] (2 species)
    not a true protein
  7. 2006780Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries)
  8. 2006784Domain d4fzaa1: 4fza A:11-334 [252094]
    Other proteins in same PDB: d4fzaa2, d4fzab1, d4fzab2
    automated match to d4kzga_
    complexed with gol

Details for d4fzaa1

PDB Entry: 4fza (more details), 3.15 Å

PDB Description: Crystal structure of MST4-MO25 complex
PDB Compounds: (A:) calcium-binding protein 39

SCOPe Domain Sequences for d4fzaa1:

Sequence, based on SEQRES records: (download)

>d4fzaa1 a.118.1.15 (A:11-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaql
aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml
lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd
lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi
skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq
ndrtedeqfndektylvkqirdlk

Sequence, based on observed residues (ATOM records): (download)

>d4fzaa1 a.118.1.15 (A:11-334) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygnekepqteavaqla
qelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmll
kgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdl
ltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyis
kpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqn
drtedeqfndektylvkqirdlk

SCOPe Domain Coordinates for d4fzaa1:

Click to download the PDB-style file with coordinates for d4fzaa1.
(The format of our PDB-style files is described here.)

Timeline for d4fzaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fzaa2