![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.1: ARM repeat [48371] (28 families) ![]() |
![]() | Family a.118.1.15: Mo25 protein [101407] (2 proteins) automatically mapped to Pfam PF08569 this is a repeat family; one repeat unit is 1upl A:195-240 found in domain |
![]() | Protein automated matches [191051] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries) |
![]() | Domain d4fzaa1: 4fza A:11-334 [252094] Other proteins in same PDB: d4fzaa2, d4fzab1, d4fzab2 automated match to d4kzga_ complexed with gol |
PDB Entry: 4fza (more details), 3.15 Å
SCOPe Domain Sequences for d4fzaa1:
Sequence, based on SEQRES records: (download)
>d4fzaa1 a.118.1.15 (A:11-334) automated matches {Human (Homo sapiens) [TaxId: 9606]} spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaql aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq ndrtedeqfndektylvkqirdlk
>d4fzaa1 a.118.1.15 (A:11-334) automated matches {Human (Homo sapiens) [TaxId: 9606]} spadivknlkesmavlekqdisdkkaekateevsknlvamkeilygnekepqteavaqla qelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfmll kgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkdl ltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyis kpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfqn drtedeqfndektylvkqirdlk
Timeline for d4fzaa1: