Lineage for d4fvvb1 (4fvv B:863-1076)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (53 species)
    not a true protein
  7. 2044196Species Clostridium botulinum [TaxId:1491] [225675] (23 PDB entries)
  8. 2044221Domain d4fvvb1: 4fvv B:863-1076 [252087]
    Other proteins in same PDB: d4fvva2, d4fvvb2
    automated match to d3r4sa1
    complexed with gol, sia, so4

Details for d4fvvb1

PDB Entry: 4fvv (more details), 2.7 Å

PDB Description: Crystal structure of HCR/D-Sa-GBL1/C
PDB Compounds: (B:) Neurotoxin

SCOPe Domain Sequences for d4fvvb1:

Sequence, based on SEQRES records: (download)

>d4fvvb1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkeltginfskti
tfqmnkipntglitsdsdninmwirdfyifakel

Sequence, based on observed residues (ATOM records): (download)

>d4fvvb1 b.29.1.0 (B:863-1076) automated matches {Clostridium botulinum [TaxId: 1491]}
sindskilslqnkkntlmdtsgynaevrvegnvqlnpifpfdfklgssgddrgkvivtqn
enivynamyesfsisfwirinkwvsnlpgytiidsvknnsgwsigiisnflvftlkqnen
seqdinfsydisknaagynkwffvtittnmmgnmmiyingklidtikvkltginfsktit
fqmnkipntgsdninmwirdfyifakel

SCOPe Domain Coordinates for d4fvvb1:

Click to download the PDB-style file with coordinates for d4fvvb1.
(The format of our PDB-style files is described here.)

Timeline for d4fvvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fvvb2