Lineage for d4fu6a_ (4fu6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1784737Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 1784908Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 1784909Protein automated matches [191144] (3 species)
    not a true protein
  7. 1784919Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries)
  8. 1784951Domain d4fu6a_: 4fu6 A: [252084]
    automated match to d2b8aa1
    complexed with gol, so4, unx

Details for d4fu6a_

PDB Entry: 4fu6 (more details), 2.1 Å

PDB Description: crystal structure of the psip1 pwwp domain
PDB Compounds: (A:) PC4 and SFRS1-interacting protein

SCOPe Domain Sequences for d4fu6a_:

Sequence, based on SEQRES records: (download)

>d4fu6a_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgmtrdfkpgdlifakmkgyphwparvdevpdgavkpptnklpifffgthetaflg
pkdifpysenkekygkpnkrkgfneglweidnnpkvk

Sequence, based on observed residues (ATOM records): (download)

>d4fu6a_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgmtrdfkpgdlifakmkgyphwparvdevpdvkpptnklpifffgthetaflgpk
difpysenkekygkpnkrkgfneglweidnnpkvk

SCOPe Domain Coordinates for d4fu6a_:

Click to download the PDB-style file with coordinates for d4fu6a_.
(The format of our PDB-style files is described here.)

Timeline for d4fu6a_: