SCOPe 2.05: Domain d4frrj_: 4frr J:

Lineage for d4frrj_ (4frr J:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (44 PDB entries)

8. Domain d4frrj_: 4frr J: [252083]
   automated match to d2c9ta_
   complexed with 0vc, gol

Details for d4frrj_

PDB Entry: 4frr, 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein from aplysia californica in presence of 3-((s)-azetidin-2-ylmethoxy)-5-((1s,2r)-2- (2-methoxyethyl)cyclopropyl)pyridine

PDB Compounds: (J:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4frrj_:

Sequence; same for both SEQRES and ATOM records:

>d4frrj_ b.96.1.0 (J:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
ddddklhsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvy
yeqqrwklnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgs
vmfipaqrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyassky
eilsatqtrqvqhysccpepyidvnlvvkfrerr

Timeline for d4frrj_:

• d4frrj_ first appeared in SCOPe 2.04
  
• d4frrj_ is called d4frrj1 in SCOPe 2.06
  
• d4frrj_ appears in the current release, SCOPe 2.08, called d4frrj1