Class b: All beta proteins [48724] (180 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.0: automated matches [193505] (1 protein) not a true family |
Protein automated matches [193506] (5 species) not a true protein |
Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries) |
Domain d4frrj1: 4frr J:1-208 [252083] Other proteins in same PDB: d4frra2, d4frrb2, d4frrc2, d4frrd2, d4frre2, d4frrf2, d4frrg2, d4frrh2, d4frri2, d4frrj2 automated match to d2c9ta_ complexed with 0vc, gol |
PDB Entry: 4frr (more details), 2.2 Å
SCOPe Domain Sequences for d4frrj1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4frrj1 b.96.1.0 (J:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]} hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat qtrqvqhysccpepyidvnlvvkfrerr
Timeline for d4frrj1: