Lineage for d4frri1 (4frr I:1-207)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820261Domain d4frri1: 4frr I:1-207 [252082]
    Other proteins in same PDB: d4frra2, d4frrb2, d4frrc2, d4frrd2, d4frre2, d4frrf2, d4frrg2, d4frrh2, d4frri2, d4frrj2
    automated match to d2c9ta_
    complexed with 0vc, gol

Details for d4frri1

PDB Entry: 4frr (more details), 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein from aplysia californica in presence of 3-((s)-azetidin-2-ylmethoxy)-5-((1s,2r)-2- (2-methoxyethyl)cyclopropyl)pyridine
PDB Compounds: (I:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4frri1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4frri1 b.96.1.0 (I:1-207) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d4frri1:

Click to download the PDB-style file with coordinates for d4frri1.
(The format of our PDB-style files is described here.)

Timeline for d4frri1: