SCOP 1.55: Domain d1et6a1: 1et6 A:2A-95

Lineage for d1et6a1 (1et6 A:2A-95)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Streptococcal superantigen Smez-2 [50236] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries)

8. Domain d1et6a1: 1et6 A:2A-95 [25208]
   Other proteins in same PDB: d1et6a2, d1et6b2

Details for d1et6a1

PDB Entry: 1et6, 1.9 Å

PDB Description: crystal structure of the superantigen smez-2 from streptococcus pyogenes

SCOP Domain Sequences for d1et6a1:

Sequence; same for both SEQRES and ATOM records:

>d1et6a1 b.40.2.2 (A:2A-95) Streptococcal superantigen Smez-2 {Streptococcus pyogenes}
glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand
fktgdkiavfsvpfdwnylskgkvtaytyggitpyq

Timeline for d1et6a1:

• d1et6a1 appears in SCOP 1.57
  
• d1et6a1 appears in the current release, SCOPe 2.08