SCOPe 2.06: Domain d4frrc1: 4frr C:1-208

Lineage for d4frrc1 (4frr C:1-208)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (6 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (48 PDB entries)

8. Domain d4frrc1: 4frr C:1-208 [252076]
   Other proteins in same PDB: d4frra2, d4frrb2, d4frrc2, d4frrd2, d4frre2, d4frrf2, d4frrg2, d4frrh2, d4frri2, d4frrj2
   automated match to d2c9ta_
   complexed with 0vc, gol

Details for d4frrc1

PDB Entry: 4frr, 2.2 Å

PDB Description: x-ray structure of acetylcholine binding protein from aplysia californica in presence of 3-((s)-azetidin-2-ylmethoxy)-5-((1s,2r)-2- (2-methoxyethyl)cyclopropyl)pyridine

PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d4frrc1:

Sequence, based on SEQRES records:

>d4frrc1 b.96.1.0 (C:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d4frrc1 b.96.1.0 (C:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

Timeline for d4frrc1:

• d4frrc1 first appeared in SCOPe 2.04, called d4frrc_
  
• d4frrc1 was called d4frrc_ in SCOPe 2.05
  
• d4frrc1 appears in SCOPe 2.07
  
• d4frrc1 appears in the current release, SCOPe 2.08