SCOPe 2.07: Domain d4fqza1: 4fqz A:1-154

Lineage for d4fqza1 (4fqz A:1-154)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187655] (107 PDB entries)

8. Domain d4fqza1: 4fqz A:1-154 [252072]
   automated match to d3ap6d_
   complexed with bgc, edo, gal; mutant

Details for d4fqza1

PDB Entry: 4fqz, 2.8 Å

PDB Description: crystal structure of a protease-resistant mutant form of human galectin-8

PDB Compounds: (A:) Galectin-8

SCOPe Domain Sequences for d4fqza1:

Sequence; same for both SEQRES and ATOM records:

>d4fqza1 b.29.1.0 (A:1-154) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mmlslnnlqniiynpvipfvgtipdqldpgtlivirghvpsdadrfqvdlqngssmkpra
dvafhfnprfkragcivcntlinekwgreeitydtpfkreksfeivimvlkdkfqvavng
khtllyghrigpekidtlgiygkvnihsigfsfs

Timeline for d4fqza1:

• d4fqza1 first appeared in SCOPe 2.04
  
• d4fqza1 appears in SCOPe 2.06
  
• d4fqza1 appears in the current release, SCOPe 2.08