SCOPe 2.04: Domain d4fq1l2: 4fq1 L:109-209

Lineage for d4fq1l2 (4fq1 L:109-209)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d4fq1l2: 4fq1 L:109-209 [252070]
   automated match to d1etza2
   complexed with nag

Details for d4fq1l2

PDB Entry: 4fq1, 3 Å

PDB Description: crystal structure of pgt121 fab

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4fq1l2:

Sequence; same for both SEQRES and ATOM records:

>d4fq1l2 b.1.1.0 (L:109-209) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Timeline for d4fq1l2:

• d4fq1l2 is new in SCOPe 2.04-stable
  
• d4fq1l2 appears in SCOPe 2.05
  
• d4fq1l2 appears in the current release, SCOPe 2.08