![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein Streptococcal superantigen Smez-2 [50236] (1 species) |
![]() | Species Streptococcus pyogenes [TaxId:1314] [50237] (2 PDB entries) |
![]() | Domain d1eu3a1: 1eu3 A:2A-96 [25206] Other proteins in same PDB: d1eu3a2, d1eu3b2, d1eu3b3 complexed with k, po4, zn |
PDB Entry: 1eu3 (more details), 1.68 Å
SCOPe Domain Sequences for d1eu3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu3a1 b.40.2.2 (A:2A-96) Streptococcal superantigen Smez-2 {Streptococcus pyogenes [TaxId: 1314]} glevdnnsllrniystivyeysdividfktshnlvtkkldvrdardffinsemdeyaand fktgdkiavfsvpfdwnylskgkvtaytyggitpyqk
Timeline for d1eu3a1: