Lineage for d1eu4a1 (1eu4 A:1-95)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) 
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins) 
Protein Streptococcal superantigen Spe-H [50234] (1 species) Species Streptococcus pyogenes [TaxId:1314] [50235] (2 PDB entries) 
Domain d1eu4a1: 1eu4 A:1-95 [25205]
Other proteins in same PDB: d1eu4a2
Details for d1eu4a1
PDB Entry: 1eu4 (more details), 2.5 Å
PDB Description: crystal structure of the superantigen spe-h (zinc bound) from streptococcus pyogenes
SCOP Domain Sequences for d1eu4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eu4a1 b.40.2.2 (A:1-95) Streptococcal superantigen Spe-H {Streptococcus pyogenes}
nsynttnrhnleslykhdsnlieadsiknspdivtshmlkysvkdknlsvffekdwisqe
fkdkevdiyalsaqevcecpgkryeafggitltns
SCOP Domain Coordinates for d1eu4a1:
Click to download the PDB-style file with coordinates for d1eu4a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eu4a1:
- d1eu4a1 appears in SCOP 1.57
- d1eu4a1 appears in the current release, SCOPe 2.08
View in 3D
