Lineage for d4fo6a1 (4fo6 A:252-328)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493397Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1493774Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1493775Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 1493942Protein DNA polymerase lambda [101251] (1 species)
  7. 1493943Species Human (Homo sapiens) [TaxId:9606] [101252] (26 PDB entries)
  8. 1493945Domain d4fo6a1: 4fo6 A:252-328 [252040]
    Other proteins in same PDB: d4fo6a2, d4fo6a3
    automated match to d1rzta1
    protein/DNA complex; complexed with cl, f2a, mg, mn, na

Details for d4fo6a1

PDB Entry: 4fo6 (more details), 2.01 Å

PDB Description: Crystal structure of the pre-catalytic ternary complex of polymerase lambda with a dATP analog opposite a templating T and an rCMP at the primer terminus.
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d4fo6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fo6a1 a.60.6.1 (A:252-328) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
hnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacsipgigkrmae
kiieilesghlrkldhi

SCOPe Domain Coordinates for d4fo6a1:

Click to download the PDB-style file with coordinates for d4fo6a1.
(The format of our PDB-style files is described here.)

Timeline for d4fo6a1: