SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4fmdd_ (4fmd D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2110099Family c.37.1.8: G proteins [52592] (79 protein domains)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2110670Protein Rab1a [142241] (1 species)
  7. 2110671Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries)
    Uniprot P62820 7-175
  8. 2110676Domain d4fmdd_: 4fmd D: [252038]
    automated match to d3l0ib_
    complexed with af3, gdp, mg, peg, pge

Details for d4fmdd_

PDB Entry: 4fmd (more details), 3.05 Å

PDB Description: EspG-Rab1 complex structure at 3.05 A
PDB Compounds: (D:) Ras-related protein Rab-1A

SCOPe Domain Sequences for d4fmdd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fmdd_ c.37.1.8 (D:) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm

SCOPe Domain Coordinates for d4fmdd_:

Click to download the PDB-style file with coordinates for d4fmdd_.
(The format of our PDB-style files is described here.)

Timeline for d4fmdd_: