| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
| Protein Rab1a [142241] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [142242] (3 PDB entries) Uniprot P62820 7-175 |
| Domain d4fmdb_: 4fmd B: [252037] automated match to d3l0ib_ complexed with af3, gdp, mg, peg, pge |
PDB Entry: 4fmd (more details), 3.05 Å
SCOPe Domain Sequences for d4fmdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fmdb_ c.37.1.8 (B:) Rab1a {Human (Homo sapiens) [TaxId: 9606]}
peydylfkllligdsgvgksclllrfaddtytesyistigvdfkirtieldgktiklqiw
dtagqerfrtitssyyrgahgiivvydvtdqesfnnvkqwlqeidryasenvnkllvgnk
cdlttkkvvdyttakefadslgipfletsaknatnveqsfmtmaaeikkrm
Timeline for d4fmdb_: