Lineage for d4fl6b3 (4fl6 B:448-544)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784802Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2784803Protein automated matches [191144] (3 species)
    not a true protein
  7. 2784818Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2784882Domain d4fl6b3: 4fl6 B:448-544 [252032]
    automated match to d1oz3a3
    complexed with unx, uwn

Details for d4fl6b3

PDB Entry: 4fl6 (more details), 2.55 Å

PDB Description: crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215
PDB Compounds: (B:) Lethal(3)malignant brain tumor-like protein 3

SCOPe Domain Sequences for d4fl6b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl6b3 b.34.9.0 (B:448-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswdkyleetnslpaparafkvkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkv
hfdgwnncydywidadspdihpvgwcsktghplqppl

SCOPe Domain Coordinates for d4fl6b3:

Click to download the PDB-style file with coordinates for d4fl6b3.
(The format of our PDB-style files is described here.)

Timeline for d4fl6b3: