SCOPe 2.07: Domain d1hqrd1: 1hqr D:503-595

Lineage for d1hqrd1 (1hqr D:503-595)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Streptococcal superantigen Spe-C [50232] (1 species)

7. Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)

8. Domain d1hqrd1: 1hqr D:503-595 [25203]
   Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd2
   complexed with zn

Details for d1hqrd1

PDB Entry: 1hqr, 3.2 Å

PDB Description: crystal structure of a superantigen bound to the high-affinity, zinc-dependent site on mhc class ii

PDB Compounds: (D:) streptococcal pyrogenic exotoxin c

SCOPe Domain Sequences for d1hqrd1:

Sequence; same for both SEQRES and ATOM records:

>d1hqrd1 b.40.2.2 (D:503-595) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

Timeline for d1hqrd1:

• d1hqrd1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqrd1 appears in SCOPe 2.06
  
• d1hqrd1 appears in the current release, SCOPe 2.08