| Class b: All beta proteins [48724] (141 folds) |
| Fold b.40: OB-fold [50198] (10 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) ![]() |
| Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (12 proteins) |
| Protein Streptococcal superantigen Spe-C [50232] (1 species) |
| Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries) |
| Domain d1hqrd1: 1hqr D:503-595 [25203] Other proteins in same PDB: d1hqra1, d1hqra2, d1hqrb1, d1hqrb2, d1hqrd2 complexed with zn |
PDB Entry: 1hqr (more details), 3.2 Å
SCOP Domain Sequences for d1hqrd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hqrd1 b.40.2.2 (D:503-595) Streptococcal superantigen Spe-C {Streptococcus pyogenes}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn
Timeline for d1hqrd1:
View in 3DDomains from other chains: (mouse over for more information) d1hqra1, d1hqra2, d1hqrb1, d1hqrb2 |