|  | Class b: All beta proteins [48724] (176 folds) | 
|  | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix | 
|  | Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)  | 
|  | Family b.34.9.0: automated matches [191625] (1 protein) not a true family | 
|  | Protein automated matches [191144] (3 species) not a true protein | 
|  | Species Human (Homo sapiens) [TaxId:9606] [189286] (20 PDB entries) | 
|  | Domain d4fl6a3: 4fl6 A:448-544 [252029] automated match to d1oz3a3 complexed with unx, uwn | 
PDB Entry: 4fl6 (more details), 2.55 Å
SCOPe Domain Sequences for d4fl6a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fl6a3 b.34.9.0 (A:448-544) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fswdkyleetnslpaparafkvkpphgfqkkmklevvdkrnpmfirvatvadtddhrvkv
hfdgwnncydywidadspdihpvgwcsktghplqppl
Timeline for d4fl6a3: