SCOPe 2.08: Domain d4fl6a2: 4fl6 A:340-447

Lineage for d4fl6a2 (4fl6 A:340-447)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.0: automated matches [191625] (1 protein)
   not a true family

6. Protein automated matches [191144] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)

8. Domain d4fl6a2: 4fl6 A:340-447 [252028]
   automated match to d1oz2a2
   complexed with unx, uwn

Details for d4fl6a2

PDB Entry: 4fl6, 2.55 Å

PDB Description: crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215

PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein 3

SCOPe Domain Sequences for d4fl6a2:

Sequence, based on SEQRES records:

>d4fl6a2 b.34.9.0 (A:340-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnwqtylktckaqaapkslfenqnitvipsgfrvgmkleavdkknpsficvatvtdmvdn
rflvhfdnwdesydywceassphihpvgwckehrrtlitppgypnvkh

Sequence, based on observed residues (ATOM records):

>d4fl6a2 b.34.9.0 (A:340-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fnwqtylktckaqaapkslfevipsgfrvgmkleavdkknpsficvatvtdmvdnrflvh
fdnwdesydywceassphihpvgwckehrrtlitppgypnvkh

Timeline for d4fl6a2:

• d4fl6a2 first appeared in SCOPe 2.04
  
• d4fl6a2 appears in SCOPe 2.07