Lineage for d4fl6a1 (4fl6 A:231-339)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2378441Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2378627Family b.34.9.0: automated matches [191625] (1 protein)
    not a true family
  6. 2378628Protein automated matches [191144] (3 species)
    not a true protein
  7. 2378638Species Human (Homo sapiens) [TaxId:9606] [189286] (22 PDB entries)
  8. 2378682Domain d4fl6a1: 4fl6 A:231-339 [252027]
    automated match to d1oz3a1
    complexed with unx, uwn

Details for d4fl6a1

PDB Entry: 4fl6 (more details), 2.55 Å

PDB Description: crystal structure of the complex of the 3-mbt repeat domain of l3mbtl3 and unc1215
PDB Compounds: (A:) Lethal(3)malignant brain tumor-like protein 3

SCOPe Domain Sequences for d4fl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fl6a1 b.34.9.0 (A:231-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
awcwasyleeekavavpaklfkehqsfpynkngfkvgmklegvdpehqsvycvltvaevc
gyriklhfdgysdcydfwvnadaldihpvgwcektghklhppkgykeee

SCOPe Domain Coordinates for d4fl6a1:

Click to download the PDB-style file with coordinates for d4fl6a1.
(The format of our PDB-style files is described here.)

Timeline for d4fl6a1: