Lineage for d1an8a1 (1an8 A:3-95)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789099Protein Streptococcal superantigen Spe-C [50232] (1 species)
  7. 2789100Species Streptococcus pyogenes [TaxId:1314] [50233] (3 PDB entries)
  8. 2789101Domain d1an8a1: 1an8 A:3-95 [25202]
    Other proteins in same PDB: d1an8a2

Details for d1an8a1

PDB Entry: 1an8 (more details), 2.4 Å

PDB Description: crystal structure of the streptococcal superantigen spe-c
PDB Compounds: (A:) streptococcal pyrogenic exotoxin c

SCOPe Domain Sequences for d1an8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1an8a1 b.40.2.2 (A:3-95) Streptococcal superantigen Spe-C {Streptococcus pyogenes [TaxId: 1314]}
kkdisnvksdllyaytitpydykdcrvnfstthtlnidtqkyrgkdyyissemsyeasqk
fkrddhvdvfglfyilnshtgeyiyggitpaqn

SCOPe Domain Coordinates for d1an8a1:

Click to download the PDB-style file with coordinates for d1an8a1.
(The format of our PDB-style files is described here.)

Timeline for d1an8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1an8a2