Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
Protein Staphylococcal enterotoxin H, SEH [50230] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries) |
Domain d1f77b1: 1f77 B:2-101 [25201] Other proteins in same PDB: d1f77a2, d1f77b2 complexed with so4 |
PDB Entry: 1f77 (more details), 2.4 Å
SCOPe Domain Sequences for d1f77b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f77b1 b.40.2.2 (B:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]} dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad laqkfknknvdiygasfyykcekiseniseclyggttlns
Timeline for d1f77b1: