SCOP 1.57: Domain d1f77b1: 1f77 B:2-101

Lineage for d1f77b1 (1f77 B:2-101)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.40: OB-fold [50198] (7 superfamilies)

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (11 proteins)

6. Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50231] (4 PDB entries)

8. Domain d1f77b1: 1f77 B:2-101 [25201]
   Other proteins in same PDB: d1f77a2, d1f77b2

Details for d1f77b1

PDB Entry: 1f77, 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution

SCOP Domain Sequences for d1f77b1:

Sequence; same for both SEQRES and ATOM records:

>d1f77b1 b.40.2.2 (B:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

Timeline for d1f77b1:

• d1f77b1 first appeared (with stable ids) in SCOP 1.55
  
• d1f77b1 appears in SCOP 1.59
  
• d1f77b1 appears in the current release, SCOPe 2.08