Lineage for d1f77a1 (1f77 A:2-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2788203Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2788945Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2789043Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 2789044Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries)
  8. 2789048Domain d1f77a1: 1f77 A:2-101 [25200]
    Other proteins in same PDB: d1f77a2, d1f77b2
    complexed with so4

Details for d1f77a1

PDB Entry: 1f77 (more details), 2.4 Å

PDB Description: staphylococcal enterotoxin h determined to 2.4 a resolution
PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1f77a1:

Sequence, based on SEQRES records: (download)

>d1f77a1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

Sequence, based on observed residues (ATOM records): (download)

>d1f77a1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekisniseclyggttlns

SCOPe Domain Coordinates for d1f77a1:

Click to download the PDB-style file with coordinates for d1f77a1.
(The format of our PDB-style files is described here.)

Timeline for d1f77a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1f77a2