Lineage for d1ewca1 (1ewc A:2-101)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059165Protein Staphylococcal enterotoxin H, SEH [50230] (1 species)
  7. 2059166Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries)
  8. 2059168Domain d1ewca1: 1ewc A:2-101 [25199]
    Other proteins in same PDB: d1ewca2
    complexed with zn

Details for d1ewca1

PDB Entry: 1ewc (more details), 1.95 Å

PDB Description: crystal structure of zn2+ loaded staphylococcal enterotoxin h
PDB Compounds: (A:) enterotoxin h

SCOPe Domain Sequences for d1ewca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ewca1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]}
dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad
laqkfknknvdiygasfyykcekiseniseclyggttlns

SCOPe Domain Coordinates for d1ewca1:

Click to download the PDB-style file with coordinates for d1ewca1.
(The format of our PDB-style files is described here.)

Timeline for d1ewca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ewca2