![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) ![]() |
![]() | Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin H, SEH [50230] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [50231] (5 PDB entries) |
![]() | Domain d1enfa1: 1enf A:2-101 [25198] Other proteins in same PDB: d1enfa2 complexed with so4 |
PDB Entry: 1enf (more details), 1.69 Å
SCOPe Domain Sequences for d1enfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1enfa1 b.40.2.2 (A:2-101) Staphylococcal enterotoxin H, SEH {Staphylococcus aureus [TaxId: 1280]} dlhdkseltdlalanaygqynhpfikeniksdeisgekdlifrnqgdsgndlrvkfatad laqkfknknvdiygasfyykcekiseniseclyggttlns
Timeline for d1enfa1: