Lineage for d4fhja2 (4fhj A:357-522)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2772795Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (4 families) (S)
    two constituent families are related by circular permutation
  5. 2772796Family b.7.1.1: PLC-like (P variant) [49563] (12 proteins)
  6. 2772819Protein Phoshoinositide 3-kinase (PI3K) [49570] (2 species)
  7. 2772820Species Human (Homo sapiens) [TaxId:9606] [49572] (70 PDB entries)
  8. 2772864Domain d4fhja2: 4fhj A:357-522 [251971]
    Other proteins in same PDB: d4fhja1, d4fhja3, d4fhja4
    automated match to d1e8wa2
    complexed with 0tz, so4

Details for d4fhja2

PDB Entry: 4fhj (more details), 2.6 Å

PDB Description: crystal structure of pi3k-gamma in complex with imidazopyridine 2
PDB Compounds: (A:) Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d4fhja2:

Sequence, based on SEQRES records: (download)

>d4fhja2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d4fhja2 b.7.1.1 (A:357-522) Phoshoinositide 3-kinase (PI3K) {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvldltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlefsiki
kdlpkgallnlqiycvqllyyvnlllidhrfllrrgeyvlhmwqissfnadkltsatnpd
kensmsisilldn

SCOPe Domain Coordinates for d4fhja2:

Click to download the PDB-style file with coordinates for d4fhja2.
(The format of our PDB-style files is described here.)

Timeline for d4fhja2: