SCOPe 2.07: Domain d4fg6d2: 4fg6 D:107-211

Lineage for d4fg6d2 (4fg6 D:107-211)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)

8. Domain d4fg6d2: 4fg6 D:107-211 [251967]
   Other proteins in same PDB: d4fg6a_, d4fg6b_, d4fg6d1, d4fg6f1
   automated match to d1ikfl2
   mutant

Details for d4fg6d2

PDB Entry: 4fg6, 3.02 Å

PDB Description: structure of ecclc e148a mutant in glutamate

PDB Compounds: (D:) Fab Fragment (Light Chain)

SCOPe Domain Sequences for d4fg6d2:

Sequence; same for both SEQRES and ATOM records:

>d4fg6d2 b.1.1.2 (D:107-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnra

Timeline for d4fg6d2:

• d4fg6d2 first appeared in SCOPe 2.04
  
• d4fg6d2 appears in SCOPe 2.06
  
• d4fg6d2 appears in the current release, SCOPe 2.08