Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.20: Clc chloride channel [81341] (1 superfamily) core: 18 transmembrane helices |
Superfamily f.20.1: Clc chloride channel [81340] (1 family) |
Family f.20.1.1: Clc chloride channel [69912] (2 proteins) duplication: consist of two similar structural parts |
Protein automated matches [226846] (4 species) not a true protein |
Species Shigella sonnei [TaxId:300269] [256257] (1 PDB entry) |
Domain d4fg6a_: 4fg6 A: [251964] Other proteins in same PDB: d4fg6d1, d4fg6d2, d4fg6f1, d4fg6f2 automated match to d1kpla_ mutant |
PDB Entry: 4fg6 (more details), 3.02 Å
SCOPe Domain Sequences for d4fg6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fg6a_ f.20.1.1 (A:) automated matches {Shigella sonnei [TaxId: 300269]} rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl gtlgggmvlgragptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla qftggkplysailartlakqeaeq
Timeline for d4fg6a_: